Loading...
Statistics
Advertisement

Myiqe.com

Advertisement
Myiqe.com is hosted in Virgin Islands, British . Myiqe.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Myiqe.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Myiqe.com

Missing HTTPS protocol.

    Meta - Myiqe.com

    Number of occurences: 2
    • Name: robots
      Content: noarchive
    • Name: googlebot
      Content: nosnippet

    Server / Hosting

    • IP: 208.91.197.39
    • Latitude: 18.50
    • Longitude: -64.50
    • Country: Virgin Islands, British

    Rname

    • dns103.a.register.com
    • dns249.d.register.com
    • dns117.b.register.com
    • dns109.c.register.com
    • p.webcom.ctmail.com

    Target

    • root.register.com

    HTTP Header Response

    HTTP/1.1 200 OK Date: Tue, 30 Aug 2016 16:49:15 GMT Server: Apache Set-Cookie: vsid=920vr2201213556207868; expires=Sun, 29-Aug-2021 16:49:15 GMT; path=/; domain=www.myiqe.com; httponly Vary: Accept-Encoding,User-Agent Content-Length: 272 Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive

    DNS

    host: myiqe.com
    1. class: IN
    2. ttl: 14400
    3. type: A
    4. ip: 208.91.197.39
    host: myiqe.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: dns103.a.register.com
    host: myiqe.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: dns249.d.register.com
    host: myiqe.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: dns117.b.register.com
    host: myiqe.com
    1. class: IN
    2. ttl: 14400
    3. type: NS
    4. target: dns109.c.register.com
    host: myiqe.com
    1. class: IN
    2. ttl: 14400
    3. type: SOA
    4. mname: dns103.a.register.com
    5. rname: root.register.com
    6. serial: 2016070205
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 14400
    host: myiqe.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: p.webcom.ctmail.com

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.yiqe.com, www.mpyiqe.com, www.pyiqe.com, www.moyiqe.com, www.oyiqe.com, www.miyiqe.com, www.iyiqe.com, www.mkyiqe.com, www.kyiqe.com, www.m.yiqe.com, www..yiqe.com, www.muyiqe.com, www.uyiqe.com, www.mjyiqe.com, www.jyiqe.com, www.mnyiqe.com, www.nyiqe.com, www.m-yiqe.com, www.-yiqe.com, www.miqe.com, www.myziqe.com, www.mziqe.com, www.myaiqe.com, www.maiqe.com, www.mysiqe.com, www.msiqe.com, www.mydiqe.com, www.mdiqe.com, www.myiqe.com, www.miqe.com, www.myciqe.com, www.mciqe.com, www.my iqe.com, www.m iqe.com, www.myqe.com, www.myirqe.com, www.myrqe.com, www.myifqe.com, www.myfqe.com, www.myivqe.com, www.myvqe.com, www.myikqe.com, www.mykqe.com, www.myi,qe.com, www.my,qe.com, www.myibqe.com, www.mybqe.com, www.myigqe.com, www.mygqe.com, www.myitqe.com, www.mytqe.com, www.myiyqe.com, www.myyqe.com, www.myiuqe.com, www.myuqe.com, www.myijqe.com, www.myjqe.com, www.myimqe.com, www.mymqe.com, www.myinqe.com, www.mynqe.com, www.myie.com, www.myiqee.com, www.myiee.com, www.myiqre.com, www.myire.com, www.myiqve.com, www.myive.com, www.myiqbe.com, www.myibe.com, www.myiqne.com, www.myine.com, www.myiqfe.com, www.myife.com, www.myiqge.com, www.myige.com, www.myiqhe.com, www.myihe.com, www.myiqye.com, www.myiye.com, www.myiq.com, www.myiqex.com, www.myiqx.com, www.myiqes.com, www.myiqs.com, www.myiqew.com, www.myiqw.com, www.myiqer.com, www.myiqr.com, www.myiqef.com, www.myiqf.com, www.myiqev.com, www.myiqv.com, www.myiqec.com, www.myiqc.com, www.myiqeq.com, www.myiqq.com, www.myiqea.com, www.myiqa.com, www.myiqey.com, www.myiqy.com,

    Other websites we recently analyzed

    1. primertime253.info
      Scottsdale (United States) - 160.153.136.1
      Server software:
      Technology: Html
    2. radio web shalom - radiowebshalom.com
      radiowebshalom.com
      Rochester (United States) - 192.111.155.52
      Server software: Apache
      Technology: CSS, Google Font API, Html, Iframe, Javascript, Php
      Number of Javascript: 3
      Number of meta tags: 14
    3. Doug Rommel's Pool Service
      Lansing (United States) - 50.28.24.255
      Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    4. usbaring.com
      Sunnyvale (United States) - 67.195.61.46
      Server software: ATS/5.0.1
      Technology: Html
      Number of Javascript: 1
      Number of meta tags: 1
    5. Errenkoalde - Hasiera
      Spain - 212.142.226.114
      Server software: Apache
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery UI, PageSpeed Module, Php, Joomla, Twitter Button
      Number of Javascript: 11
      Number of meta tags: 5
    6. bellcellphones.com
      Road Town (Virgin Islands, British) - 208.91.196.52
      Server software: Microsoft-IIS/8.5
      Technology: Html
      Number of meta tags: 2
    7. jyvaskylanhammaslaakariasema.fi
      Finland - 217.149.52.104
      Server software: Apache/2.4.10 (Unix) OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
      Technology: Html
      Number of meta tags: 1
    8. blacksheephdfc.com
      Los Angeles (United States) - 74.124.205.131
      Server software: Apache/2
      Technology: Html
    9. Ben Ravilious - photographs and images of Leicester Singapore Devon
      Photographs of the city of Leicester. Also images of North Devon and Singapore, leicester photos, leicester photographs, leicester photographer, leicester images, leicester pictures, singapore photos, singapore photographs, singapore photographer, singapore images, singapore pictures, photos of leicester, photographs of leicester, images of leicester, pictures of leicester, leicester town hall
      Dublin (Ireland) - 52.17.153.21
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Javascript
      Number of Javascript: 1
      Number of meta tags: 12
    10. www.monkeytail.org
      San Francisco (United States) - 192.0.78.24
      Server software: nginx
      Technology: CSS, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress, Twitter Button
      Number of Javascript: 6
      Number of meta tags: 9

    Check Other Websites